PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013618812.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 322aa    MW: 36468.5 Da    PI: 9.7475
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013618812.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.13e-1680125147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v+q+G+ +W+ Ia+++  gR++k+c++rw++ 
   XP_013618812.1  80 RGHWRPTEDAKLKELVAQFGPQNWNVIANHLL-GRSGKSCRLRWFNQ 125
                      899****************************9.***********996 PP

2Myb_DNA-binding51.62.2e-16133175246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        +T+eE+++l+ +++ +G++ W++I+r ++ gRt++ +k++w+ 
   XP_013618812.1 133 TTFTEEEELRLLAVHRAYGNK-WALISRLFP-GRTDNAVKNHWHV 175
                      679******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.33975126IPR017930Myb domain
SMARTSM007171.1E-1379128IPR001005SANT/Myb domain
PfamPF002491.1E-1580125IPR001005SANT/Myb domain
SuperFamilySSF466897.49E-2880173IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.5E-2581133IPR009057Homeodomain-like
CDDcd001673.33E-1283124No hitNo description
PROSITE profilePS5129424.701127181IPR017930Myb domain
SMARTSM007172.1E-14131179IPR001005SANT/Myb domain
PfamPF002495.7E-14133174IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-19134180IPR009057Homeodomain-like
CDDcd001672.74E-10134174No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0051782Biological Processnegative regulation of cell division
GO:0071367Biological Processcellular response to brassinosteroid stimulus
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MNPNLLEKDQ TSNETIHGSR RFKEANNFRS SPKSHTNFSL ARNHPLNKTF PVLKSEDEHE  60
SENGWKRRGQ SGIKAKVCSR GHWRPTEDAK LKELVAQFGP QNWNVIANHL LGRSGKSCRL  120
RWFNQLDPRI NKTTFTEEEE LRLLAVHRAY GNKWALISRL FPGRTDNAVK NHWHVIMARR  180
TRESQRQRHQ PPQAPSGNAE MAVSSSYNHG DEFFGTVVNG TFVNDEDDEA GDDDGSAVST  240
CTTELSLTPP SSTHQLRFFN YDSTLAPGKA GGQCVQRAEV NGKYSKKLDH QNHHTITVSE  300
RKVEVKMKSG HYFFDFLGVG AS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-32801814105MYB PROTO-ONCOGENE PROTEIN
1h88_C6e-328018158159MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-328018158159MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-32801814105C-Myb DNA-Binding Domain
1msf_C2e-32801814105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00516DAPTransfer from AT5G17800Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9667390.0KC966739.1 Brassica napus MYB transcription factor 56 (MYB56.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013618812.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLA0A0D3AJL40.0A0A0D3AJL4_BRAOL; Uncharacterized protein
STRINGBra023637.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM99771836
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17800.11e-145myb domain protein 56